PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG292900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 681aa    MW: 74533.5 Da    PI: 6.8952
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG292900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.62.8e-2077133157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +++ +++t++q+++Le+ F++ ++p++++r++L+k+lgL+ rqVk+WFqNrR+++k+
  Pavir.7NG292900.1.p  77 KKRYHRHTPHQIHQLEATFKEWPHPDEKQRADLSKRLGLEPRQVKFWFQNRRTQMKN 133
                          678899************************************************995 PP

2START176.31.9e-552865112205
                          HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                          la +a++elvk+a+ +ep+W  s+        e +n +e+ ++f +  +     + +ea+r+sg+v  ++a lve +++ + +W+ ++  
  Pavir.7NG292900.1.p 286 LAMRAMDELVKMAQMNEPLWIPSVsspgsstvETLNWKEYSKTFLPCVGvkpigFVSEASRESGIVNIDSAALVEFFMNER-RWSDMFSc 374
                          6789****************99998889999989999999999988655999*****************************.******** PP

                          ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
                START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                             ka+t+e is g      gal lm+aelq+lsplvp R+++f+R++ ql +g+w++vdvSvd  +k +    ++ +++lpSg++++++
  Pavir.7NG292900.1.p 375 ivaKASTIEEISAGvagsrdGALLLMQAELQVLSPLVPrREVTFLRFCNQLAEGVWAVVDVSVDGLEKDQCLVTSMNCRRLPSGCVVQET 464
                          *****************************************************************9999889999*************** PP

                          CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          +ng +kvtwveh+++ ++++h+l+r+l++sgla ga +w+atlqrqce
  Pavir.7NG292900.1.p 465 PNG-CKVTWVEHTEYHEASVHQLYRPLLRSGLALGAGRWLATLQRQCE 511
                          ***.*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-2162134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2263128IPR009057Homeodomain-like
PROSITE profilePS5007117.8874134IPR001356Homeobox domain
SMARTSM003899.4E-1975138IPR001356Homeobox domain
CDDcd000861.36E-1976135No hitNo description
PfamPF000461.0E-1777132IPR001356Homeobox domain
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PROSITE profilePS5084843.887276515IPR002913START domain
SuperFamilySSF559611.24E-31279512No hitNo description
CDDcd088753.94E-106280511No hitNo description
SMARTSM002347.9E-45285512IPR002913START domain
PfamPF018521.8E-47286511IPR002913START domain
SuperFamilySSF559618.93E-10535624No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MRACFVADWL QDDAGRRRDG SGERAGSVAR GGGGGGGNAK DAPEGEDDSR SPMSGHLDVV  60
LAGGGEDDED GNPRKRKKRY HRHTPHQIHQ LEATFKEWPH PDEKQRADLS KRLGLEPRQV  120
KFWFQNRRTQ MKNQMERHEN TMLKLENDKL RAENLSIREA MRDAACSGCG GPALLGEMSL  180
EEHHLRLENA RLRDELTRVC ALTAKFIAKP LSPMALPPVQ QPHPMPVSSL DLAVTCVGSM  240
PPSTMPVSTI SELAGSVSSQ MGTVITPAVT TPLVMGSGDK SMFVQLAMRA MDELVKMAQM  300
NEPLWIPSVS SPGSSTVETL NWKEYSKTFL PCVGVKPIGF VSEASRESGI VNIDSAALVE  360
FFMNERRWSD MFSCIVAKAS TIEEISAGVA GSRDGALLLM QAELQVLSPL VPRREVTFLR  420
FCNQLAEGVW AVVDVSVDGL EKDQCLVTSM NCRRLPSGCV VQETPNGCKV TWVEHTEYHE  480
ASVHQLYRPL LRSGLALGAG RWLATLQRQC EGLAILMSSV AMPEHDSSAV ALGGKRSLLK  540
LAQRMMENFC AGVSASSAEW NKLDGLTGCM RKDVRVMVRK SVDEPGVPPG VVLSAATAVW  600
MPVTPERLFN FLRNEGLRAE WDILSNGGPM QQMLRIAKGQ LDGNSVTLLR ADPTNTHLNS  660
ILILQEIAPT NPVQWLCTPQ *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17278PRKRKKR
27377RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978185.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLK3Y5A80.0K3Y5A8_SETIT; Uncharacterized protein
STRINGSi009396m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1